GET /api/protein/unreviewed/A0A087QYC6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A087QYC6",
        "id": "A0A087QYC6_APTFO",
        "source_organism": {
            "taxId": "9233",
            "scientificName": "Aptenodytes forsteri",
            "fullName": "Aptenodytes forsteri (Emperor penguin)"
        },
        "name": "G-protein coupled receptors family 1 profile domain-containing protein",
        "description": [
            "High affinity receptor for melatonin. The activity of this receptor is mediated by pertussis toxin sensitive G proteins that inhibits adenylate cyclase activity"
        ],
        "length": 289,
        "sequence": "GNVFVVSLAVADLVVAIYPYPLVLTSVFHNGWNLGYLHCQISGFLMGLSVIGSIFNITGIAINRYCYICHSLKYDKLYSDKNSLCYVVLIWVLTFVAIVPNLFVGSLQYDPRIYSCTFAQSVSSAYTIAVVFFHFLLPIAIVTFCYLRIWILVIQVRRRVKPDNNPRLKPHDFRNFVTMFVVFVLFAVCWAPLNFIGLAVAVNPETIIPRIPEWLFISSYYMAYFNSCLNAIIYGLLNQNFRREYKRIIVAFCTAKVFFQDSSNDAGDRMKSKPSPLITNNNQVKVDSV",
        "proteome": "UP000053286",
        "gene": "AS27_13312",
        "go_terms": [
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0004930",
                "name": "G protein-coupled receptor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0007186",
                "name": "G protein-coupled receptor signaling pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008502",
                "name": "melatonin receptor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "ida_accession": "587fa3dbe4504dc051049f3cca904dd9ab631b87",
        "counters": {
            "domain_architectures": 340616,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "prints": 3,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 340616
        }
    }
}