GET /api/protein/unreviewed/A0A087QSW2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A087QSW2",
"id": "A0A087QSW2_APTFO",
"source_organism": {
"taxId": "9233",
"scientificName": "Aptenodytes forsteri",
"fullName": "Aptenodytes forsteri (Emperor penguin)"
},
"name": "Gap junction protein",
"description": [
"Structural component of eye lens gap junctions. Gap junctions are dodecameric channels that connect the cytoplasm of adjoining cells. They are formed by the docking of two hexameric hemichannels, one from each cell membrane. Small molecules and ions diffuse from one cell to a neighboring cell via the central pore",
"One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell"
],
"length": 399,
"sequence": "MGDWSFLGNILEQVNEQSTVIGRVWLTVLFIFRILILGTAAELVWGDEQSDFVCNTQQPGCENVCYDEAFPISHIRLWVLQIIFVSTPSLMYFGHAVHHVRMEEKRREKEEAERRQQAEVDEEKLPLAPNQNKGNNPDGTKKFRLEGTLLRTYIFHIIFKTLFEVGFIVGQYFLYGFRILPLYRCGRWPCPNLVDCFVSRPTEKTIFIMFMLVVASVSLFLNLVEISHLILKRIRRALRRPAEEQLGEVPEKPLHAITVSSIPKAKGYKLLEEEKPVSHYFPLTEVGVEPSPLPSAFNEFEEKIGMGPLEDLSRAFDERLPSYAQAKEREEEKVRAEEEEEQEEEQLAPQEELGVKKAEEVVSDEIEGSSAPAELATDMRPLSRLSKASSRARSDDLTV",
"proteome": "UP000053286",
"gene": "AS27_05145",
"go_terms": [
{
"identifier": "GO:0007154",
"name": "cell communication",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005922",
"name": "connexin complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1639888e1d303e28ba7920ac652b21bf7fe13b78",
"counters": {
"domain_architectures": 842,
"entries": 16,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 2,
"smart": 2,
"panther": 1,
"prosite": 2,
"prints": 2,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 842
}
}
}