HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A060WD75",
"id": "A0A060WD75_ONCMY",
"source_organism": {
"taxId": "8022",
"scientificName": "Oncorhynchus mykiss",
"fullName": "Oncorhynchus mykiss (Rainbow trout)"
},
"name": "ATP-sensitive inward rectifier potassium channel 11",
"description": [
"Inward rectifier potassium channel that forms the pore of ATP-sensitive potassium channels (KATP), regulating potassium permeability as a function of cytoplasmic ATP and ADP concentrations in many different cells. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium. In pancreatic cells, it forms KATP channels with ABCC8/SUR1. Can form cardiac and smooth muscle-type KATP channels with ABCC9"
],
"length": 400,
"sequence": "MLSRKGLVPDDYLLTRLAEDVQQPKFKGKARKARFVAKNGTCNVAHTNIREQGRFLQDVFTTLVDLKWLHTLIIFTMSFLCSWLLFAMAWWLIAFAHGDLDQKGDDFVPCVTDIHSFSSAFLFSIEVQVTIGFGGRMVTEECLSAIVVLIIQNIVGLLINAIMLGCIFMKTAQANRRAETLIFSKHAVISIRNNRLCFMIRLGDLRKSMIISATVRMQVVRRSTTPEGEVVPLDQIDIHMDNPVGTNGIFLVAPLIICHIINKDSPLYELSPADLQKNDIEVIVVLEGVVETTGITTQARTSYLSEEILWGQRFVPTITEEEGTYAVDYSKFGNAIRVPTPSCSAKKLDEDGGIARFKLHEHSTPRPSVRRRQLSLRIKPETVALEDLTSADLHNDALVW",
"proteome": null,
"gene": "GSONMT00067334001",
"go_terms": [
{
"identifier": "GO:0005242",
"name": "inward rectifier potassium channel activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006813",
"name": "potassium ion transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0015272",
"name": "ATP-activated inward rectifier potassium channel activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e7a59055e1b20178b6e101f48a7067c5d642e21e",
"counters": {
"domain_architectures": 15818,
"entries": 16,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"pfam": 2,
"ssf": 2,
"panther": 1,
"pirsf": 1,
"prints": 2,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 15818
}
}
}