GET /api/protein/unreviewed/A0A060CEU0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A060CEU0",
        "id": "A0A060CEU0_9EURO",
        "source_organism": {
            "taxId": "292466",
            "scientificName": "uncultured Penicillium",
            "fullName": "uncultured Penicillium"
        },
        "name": "Alpha-L-arabinofuranosidase",
        "description": [
            "Alpha-L-arabinofuranosidase involved in the hydrolysis of xylan, a major structural heterogeneous polysaccharide found in plant biomass representing the second most abundant polysaccharide in the biosphere, after cellulose"
        ],
        "length": 76,
        "sequence": "MVIGACPFSGKITGSDTGAIDQTVIGDSTHMYLFFAGDNGKIYRSSMSIDDFPGSFGTNSEVVLSGSTNDVFEAVQ",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0046556",
                "name": "alpha-L-arabinofuranosidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046373",
                "name": "L-arabinose metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "709538cc3dd220100c8fd8254eedc45785020db9",
        "counters": {
            "domain_architectures": 1450,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 1450
        }
    }
}