GET /api/protein/unreviewed/A0A051U6H3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A051U6H3",
"id": "A0A051U6H3_9MYCO",
"source_organism": {
"taxId": "1324261",
"scientificName": "Mycobacterium [tuberculosis] TKK-01-0051",
"fullName": "Mycobacterium [tuberculosis] TKK-01-0051"
},
"name": "Thiamine-monophosphate kinase",
"description": [
"Catalyzes the ATP-dependent phosphorylation of thiamine-monophosphate (TMP) to form thiamine-pyrophosphate (TPP), the active form of vitamin B1"
],
"length": 320,
"sequence": "MGGVQDESGKSLRQLGEFAVIDRLVRGREQPAAVALGPGDDAALVTSGDGRVLVSTDMLVQDRHFQLDWSTPHDIGRKAIAQNAADIEAMGGRPTAFVVAFGAPGDTPAAKVDALVDGMWDEADRIGAGIAGGDLVGCPQWVISVTVLGDPEGRAPVRRSGAKPGALIAVAGDLGHSAAGFDLWGNGIDGFEELRRRHTVPQPPYGQGAVAAAGGAQAMIDVSDGLIADLRHVAEASGVGMDLSTAALAADRDALGAAAAAVGADPWHWVLGGGEDHALVACFAGPAPAGWRIIGRVLDGPARVLVDDQEWSGYAGWQSY",
"proteome": "UP000025947",
"gene": "thiL",
"go_terms": [
{
"identifier": "GO:0009030",
"name": "thiamine-phosphate kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009228",
"name": "thiamine biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "422c6c10070c82c88bef4e6aea61447f3d744bdf",
"counters": {
"domain_architectures": 6271,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"cdd": 1,
"pfam": 1,
"ncbifam": 2,
"panther": 1,
"pirsf": 1,
"hamap": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 6271
}
}
}