GET /api/protein/unreviewed/A0A023ES98/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A023ES98",
        "id": "A0A023ES98_AEDAL",
        "source_organism": {
            "taxId": "7160",
            "scientificName": "Aedes albopictus",
            "fullName": "Aedes albopictus (Asian tiger mosquito)"
        },
        "name": "26S proteasome non-ATPase regulatory subunit 13",
        "description": [
            "Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair"
        ],
        "length": 381,
        "sequence": "MMGLPNVAGYLAEQKKTTDKELAAEWTQIEELYNEKLWNELTIKLNTFVKNPALQNEDALLTLYHNFICVFETKMNPYGLVEILTVVVSHIADKKEAIAFLEKLKXXXKVCDEALWMCKVLQGQIYLESLNELDETKKIILDLKDILEEAGNVTPVHGKYYMLAANYYRLVGQHSDYYRCGLQFLGCSMDSYPKDQWPQQAFFLGLAALLGEGIYNIGELLAHPILESLKGTENEWLVELLQAFNSGDINKFEQMKPKWSTIADLAAQEVKLRQKISLLCLMEMTFKRPANKRTITFEEIAKEAKLPIKEVEILIMKALAQGLVKGAIDEVAGVVNMTWVQPRVLDRKQVAAMASTLDTWMASITSMEQLIESRASEILTN",
        "proteome": null,
        "gene": null,
        "go_terms": null,
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "247d0041ebac1c40052ad8d9cce56187d5362ef9",
        "counters": {
            "domain_architectures": 3360,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "profile": 1,
                "smart": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 3360
        }
    }
}