General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A022S150",
        "id": "A0A022S150_ERYGU",
        "source_organism": {
            "taxId": "4155",
            "scientificName": "Erythranthe guttata",
            "fullName": "Erythranthe guttata (Yellow monkey flower)"
        },
        "name": "Uncharacterized protein",
        "description": [
            "Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the translocation pore. Directly involved in the pore formation"
        ],
        "length": 308,
        "sequence": "MATPTPPPPATAPPAAAEPQKTDYLNLPCPIPYEEISREALMSLKPELFEGMRFDFMKGLNQKFSLSHSVMMGPTEIPAQSSEIIKIPTAHYEFGANFMDPKFMLFGRVMTDGKVTARLKCDLTDNLTLKGTAQLTSEPHMSHGMFNFDYKGSDYRTQFQLGNGGLLGANYIQSVTPNLSLGGEIFWAGQHRKSGIGCAARYNTDKMVASGQVASHGIVALSYVQKVSDKVSLASDFMYNYMSRDATASFGYDYILRQARLRGKIDSNGVASAFLEERFNMGLNFILSAELDHKRKDYKFGFGLTVGE",
        "proteome": "UP000030748",
        "gene": "MIMGU_mgv1a010583mg",
        "go_terms": [
            {
                "identifier": "GO:0008320",
                "name": "transmembrane protein transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0030150",
                "name": "protein import into mitochondrial matrix",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005741",
                "name": "mitochondrial outer membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0055085",
                "name": "transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "b61af2137f24347970cf1481b12e2dc4b115f98c",
        "counters": {
            "domain_architectures": 15975,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 15975
        }
    }
}