GET /api/protein/unreviewed/A0A022RGV1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A022RGV1",
        "id": "A0A022RGV1_ERYGU",
        "source_organism": {
            "taxId": "4155",
            "scientificName": "Erythranthe guttata",
            "fullName": "Erythranthe guttata (Yellow monkey flower)"
        },
        "name": "Hydroxymethylglutaryl-CoA synthase",
        "description": [
            "Catalyzes the condensation of acetyl-CoA with acetoacetyl-CoA to form HMG-CoA"
        ],
        "length": 383,
        "sequence": "MAKNVGILAMEVYFPPTCIQQEVLEAHDGASKGKYTIGLGQDCMAFCDEVEDVISMSMTAVTSLLEKYGVDPKQIGRLEVGSETVLDKSKSIKTFLMPIFEKCGNTDIEGVDSTNACYGGTAALFNCINWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIAFESKLRASHMSHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYKSLCDKYEKMEGKQFSINDADYFVFHSPYNKLVQKSFSRLLFNDFTRAASSIDEAAKEKLSPFSSLSNDESYQSRDLEKVFNHLTYFELKRFRIVMNFRSIIINIINFIDRHHNKWRSRFTMRKYSRRHLSRNKWAICTLLRSMLHLHHSSTTKTQLWLVRG",
        "proteome": "UP000030748",
        "gene": "MIMGU_mgv1a006016mg",
        "go_terms": [
            {
                "identifier": "GO:0016746",
                "name": "acyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004421",
                "name": "hydroxymethylglutaryl-CoA synthase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006084",
                "name": "acetyl-CoA metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0010142",
                "name": "farnesyl diphosphate biosynthetic process, mevalonate pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008299",
                "name": "isoprenoid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "05016c5a272681557734614bf617618eba20d389",
        "counters": {
            "domain_architectures": 8557,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 2,
                "ssf": 1,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 8557
        }
    }
}