HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A022RGV1",
"id": "A0A022RGV1_ERYGU",
"source_organism": {
"taxId": "4155",
"scientificName": "Erythranthe guttata",
"fullName": "Erythranthe guttata (Yellow monkey flower)"
},
"name": "Hydroxymethylglutaryl-CoA synthase",
"description": [
"Catalyzes the condensation of acetyl-CoA with acetoacetyl-CoA to form HMG-CoA"
],
"length": 383,
"sequence": "MAKNVGILAMEVYFPPTCIQQEVLEAHDGASKGKYTIGLGQDCMAFCDEVEDVISMSMTAVTSLLEKYGVDPKQIGRLEVGSETVLDKSKSIKTFLMPIFEKCGNTDIEGVDSTNACYGGTAALFNCINWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIAFESKLRASHMSHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYKSLCDKYEKMEGKQFSINDADYFVFHSPYNKLVQKSFSRLLFNDFTRAASSIDEAAKEKLSPFSSLSNDESYQSRDLEKVFNHLTYFELKRFRIVMNFRSIIINIINFIDRHHNKWRSRFTMRKYSRRHLSRNKWAICTLLRSMLHLHHSSTTKTQLWLVRG",
"proteome": "UP000030748",
"gene": "MIMGU_mgv1a006016mg",
"go_terms": [
{
"identifier": "GO:0016746",
"name": "acyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004421",
"name": "hydroxymethylglutaryl-CoA synthase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006084",
"name": "acetyl-CoA metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0010142",
"name": "farnesyl diphosphate biosynthetic process, mevalonate pathway",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0008299",
"name": "isoprenoid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "05016c5a272681557734614bf617618eba20d389",
"counters": {
"domain_architectures": 8557,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 2,
"ssf": 1,
"cdd": 1,
"panther": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 8557
}
}
}