GET /api/protein/unreviewed/A0A015M8T8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A015M8T8",
        "id": "A0A015M8T8_RHIIW",
        "source_organism": {
            "taxId": "1432141",
            "scientificName": "Rhizophagus irregularis (strain DAOM 197198w)",
            "fullName": "Rhizophagus irregularis (strain DAOM 197198w)"
        },
        "name": "Signal recognition particle subunit SRP14",
        "description": [
            "Component of the signal recognition particle (SRP) complex, a ribonucleoprotein complex that mediates the cotranslational targeting of secretory and membrane proteins to the endoplasmic reticulum (ER)"
        ],
        "length": 133,
        "sequence": "MTFLDNDLFLTQLVKLFEKTKPTSKKKVYLTMKRYTWESLKTKKERKETEKSNASDKQEELQKEVDDKEYSCLVRAVYGNFKISTLVSPSDTDKFITGYSNILKVHMDSMKKKERKKEKLKAKKIQKVKATIA",
        "proteome": "UP000022910",
        "gene": "RirG_153930",
        "go_terms": [
            {
                "identifier": "GO:0008312",
                "name": "7S RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006614",
                "name": "SRP-dependent cotranslational protein targeting to membrane",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0048500",
                "name": "signal recognition particle",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0030942",
                "name": "endoplasmic reticulum signal peptide binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005786",
                "name": "signal recognition particle, endoplasmic reticulum targeting",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2ff6f03da45f94110b27a193ccd4563d512dd546",
        "counters": {
            "domain_architectures": 4129,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4129
        }
    }
}