HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A015J8Q3",
"id": "A0A015J8Q3_RHIIW",
"source_organism": {
"taxId": "1432141",
"scientificName": "Rhizophagus irregularis (strain DAOM 197198w)",
"fullName": "Rhizophagus irregularis (strain DAOM 197198w)"
},
"name": "Signal recognition particle subunit SRP14",
"description": [
"Component of the signal recognition particle (SRP) complex, a ribonucleoprotein complex that mediates the cotranslational targeting of secretory and membrane proteins to the endoplasmic reticulum (ER)"
],
"length": 102,
"sequence": "MKRYTWESLKTKKERKETEKSNASDKQEELQKEVDDKEYSCLVRAVYGNFKISTLVSPSDTDKFITGYSNILKVHMDSMKKKERKKEKLKAKKIQKVKATIA",
"proteome": "UP000022910",
"gene": "RirG_153930",
"go_terms": [
{
"identifier": "GO:0008312",
"name": "7S RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006614",
"name": "SRP-dependent cotranslational protein targeting to membrane",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0048500",
"name": "signal recognition particle",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0030942",
"name": "endoplasmic reticulum signal peptide binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005786",
"name": "signal recognition particle, endoplasmic reticulum targeting",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "2ff6f03da45f94110b27a193ccd4563d512dd546",
"counters": {
"domain_architectures": 4129,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 1,
"ssf": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4129
}
}
}