GET /api/protein/unreviewed/A0A010R4V4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A010R4V4",
"id": "A0A010R4V4_9PEZI",
"source_organism": {
"taxId": "1445577",
"scientificName": "Colletotrichum fioriniae PJ7",
"fullName": "Colletotrichum fioriniae PJ7"
},
"name": "Mitochondrial import inner membrane translocase subunit TIM50",
"description": [
"Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane"
],
"length": 395,
"sequence": "MQPSLPRIFARSQQIHQRCFYKTVARRRPGRPPRDFPRKDTISEYNAEPYLPFPTTPSRDSRLVYTPHKSMSDLQWWAKPAPAMAAPSNQQPSSNGFTIPGLGNAANVSYAPNSTTPLTXXXXXXXXXXPPPPPVSLRAAVPHNRDKIIAPSAASGGVPNPTPQYLQQASLPPTLVPTPRPILVVMDLNGTLLFRPNRRNAASFVERPHAKRFLQYCLDTFHVVVWSSAQPKNVQSMCDQLLLKGGLGAADTQEERASYRRRVLAVWGRDKFGLSEADFKLRVQVYKRLEMVWAQANVQAAHPDAAYGGRWDQTNTILVDDSLEKARSEPYNLLQIPEFFGDASEPGYVVPQVHDYLNQLCYQSDVSAYMRTNPFQLNDAYRLEQQQEGNVQGLA",
"proteome": "UP000020467",
"gene": "CFIO01_07574",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": false,
"ida_accession": "8df33b9b2c79564cda8ce6ea21c83f17a3ce11b7",
"counters": {
"domain_architectures": 27507,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"profile": 1,
"smart": 1,
"panther": 1,
"pfam": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 27507
}
}
}