General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A010R4V4",
        "id": "A0A010R4V4_9PEZI",
        "source_organism": {
            "taxId": "1445577",
            "scientificName": "Colletotrichum fioriniae PJ7",
            "fullName": "Colletotrichum fioriniae PJ7"
        },
        "name": "Mitochondrial import inner membrane translocase subunit TIM50",
        "description": [
            "Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane"
        ],
        "length": 395,
        "sequence": "MQPSLPRIFARSQQIHQRCFYKTVARRRPGRPPRDFPRKDTISEYNAEPYLPFPTTPSRDSRLVYTPHKSMSDLQWWAKPAPAMAAPSNQQPSSNGFTIPGLGNAANVSYAPNSTTPLTXXXXXXXXXXPPPPPVSLRAAVPHNRDKIIAPSAASGGVPNPTPQYLQQASLPPTLVPTPRPILVVMDLNGTLLFRPNRRNAASFVERPHAKRFLQYCLDTFHVVVWSSAQPKNVQSMCDQLLLKGGLGAADTQEERASYRRRVLAVWGRDKFGLSEADFKLRVQVYKRLEMVWAQANVQAAHPDAAYGGRWDQTNTILVDDSLEKARSEPYNLLQIPEFFGDASEPGYVVPQVHDYLNQLCYQSDVSAYMRTNPFQLNDAYRLEQQQEGNVQGLA",
        "proteome": "UP000020467",
        "gene": "CFIO01_07574",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "ida_accession": "8df33b9b2c79564cda8ce6ea21c83f17a3ce11b7",
        "counters": {
            "domain_architectures": 27507,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "smart": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 27507
        }
    }
}