GET /api/protein/reviewed/Q9XT82/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9XT82",
        "id": "PE2R2_CANLF",
        "source_organism": {
            "taxId": "9615",
            "scientificName": "Canis lupus familiaris",
            "fullName": "Canis lupus familiaris (Dog)"
        },
        "name": "Prostaglandin E2 receptor EP2 subtype",
        "description": [
            "Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. The subsequent raise in intracellular cAMP is responsible for the relaxing effect of this receptor on smooth muscle (By similarity)"
        ],
        "length": 361,
        "sequence": "MGSISNNSGSEDCESREWLPSGESPAISSAMFSAGVLGNLIALALLARRWRGDAGRRAGRGNSISLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLMALEPERRACTYFAFAMTFFSLATMLMLFAMALERYLSIGRPYFYQRHVTRRGGLAVLPTIYTVSLLFCSLPLLGYGQYVQYCPGTWCFIRHGRTAYLQLYATLLLLLIVAVLACNFSVILNLIRMHRRSGRSRCGPSLGSCRDGSGTRRRGERVSVAEETDHLILLAIMTITFAICSLPFTIFAYMNETSSRREKWDLQALRFLSINSIIDPWVFAIFRPPVLRLMRSVLCCRVSLRAQDATQTSCSIQSNASRLTFVDTS",
        "proteome": "UP000805418",
        "gene": "PTGER2",
        "go_terms": [
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0004930",
                "name": "G protein-coupled receptor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0007186",
                "name": "G protein-coupled receptor signaling pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004957",
                "name": "prostaglandin E receptor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "587fa3dbe4504dc051049f3cca904dd9ab631b87",
        "counters": {
            "domain_architectures": 394800,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "profile": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 3,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 394800
        }
    }
}