HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q9SZA4",
"id": "CDC21_ARATH",
"source_organism": {
"taxId": "3702",
"scientificName": "Arabidopsis thaliana",
"fullName": "Arabidopsis thaliana (Mouse-ear cress)"
},
"name": "Cell division cycle 20.1, cofactor of APC complex",
"description": [
"Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle"
],
"length": 457,
"sequence": "MDAGMNNTSSHYKTQARCPLQEHFLPRKPSKENLDRFIPNRSAMNFDYAHFALTEGRKGKDQTAAVSSPSKEAYRKQLAETMNLNHTRILAFRNKPQAPVELLPSNHSASLHQQPKSVKPRRYIPQTSERTLDAPDIVDDFYLNLLDWGSANVLAIALDHTVYLWDASTGSTSELVTIDEEKGPVTSINWAPDGRHVAVGLNNSEVQLWDSASNRQLRTLKGGHQSRVGSLAWNNHILTTGGMDGLIINNDVRIRSPIVETYRGHTQEVCGLKWSGSGQQLASGGNDNVVHIWDRSVASSNSTTQWLHRLEEHTSAVKALAWCPFQANLLATGGGGGDRTIKFWNTHTGACLNSVDTGSQVCSLLWSKNERELLSSHGFTQNQLTLWKYPSMVKMAELTGHTSRVLYMAQSPDGCTVASAAGDETLRFWNVFGVPETAKKAAPKAVSEPFSHVNRIR",
"proteome": "UP000006548",
"gene": "CDC20-1",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0010997",
"name": "anaphase-promoting complex binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0097027",
"name": "ubiquitin-protein transferase activator activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:1904668",
"name": "positive regulation of ubiquitin protein ligase activity",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "167636f4892637a1b8186d6077692f881f19f42b",
"counters": {
"domain_architectures": 12150,
"entries": 15,
"isoforms": 2,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"smart": 1,
"pfam": 1,
"ssf": 1,
"cdd": 1,
"profile": 2,
"panther": 1,
"prosite": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 12150
}
}
}