General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9H6D8",
        "id": "FNDC4_HUMAN",
        "source_organism": {
            "taxId": "9606",
            "scientificName": "Homo sapiens",
            "fullName": "Homo sapiens (Human)"
        },
        "name": "Fibronectin type III domain-containing protein 4",
        "description": [
            "Has anti-inflammatory properties. In the colon, acts on macrophages to down-regulate inflammation. May suppress osteoclastogenesis and mature osteoclast resorptive function. In white adipose tissue, decreases local inflammation, via interaction with GPR116. Also required for proper systemic glucose tolerance, specifically sensitizing white adipocytes to insulin and promoting glucose uptake. The insulin sensitizing function in adipose tissue is mediated by interaction with ADGRF5/GPR116 and activation of cAMP signaling"
        ],
        "length": 234,
        "sequence": "MPSGCHSSPPSGLRGDMASLVPLSPYLSPTVLLLVSCDLGFVRADRPPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQTGEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGPEQSPQGRPVGTRQKKSPSINTIDV",
        "proteome": "UP000005640",
        "gene": "FNDC4",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "34f1da63e8a9f045bcec304d8a097426cfd5ab8b",
        "counters": {
            "domain_architectures": 23932,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "smart": 1,
                "cdd": 1,
                "profile": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 23932
        }
    }
}