General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9E7N7",
        "id": "VP4A_LNYV3",
        "source_organism": {
            "taxId": "928304",
            "scientificName": "Lettuce necrotic yellows virus (isolate 318)",
            "fullName": "Lettuce necrotic yellows virus (isolate 318) (LNYV)"
        },
        "name": "Phosphoprotein",
        "description": [
            "Non catalytic polymerase cofactor and regulatory protein that plays a role in viral transcription and replication. Stabilizes the RNA polymerase L to the N-RNA template and binds the soluble protein N, preventing it from encapsidating non-genomic RNA (By similarity)"
        ],
        "length": 300,
        "sequence": "MDSESLDFSSADTVILRSPNAGTNPDGHPDTVECPDFDTDIPKTSDDSSKMDNKGSSSSSKAVKDLLELAAKSQGIVVTDVMQNTAIALHHNLGLDASSLDWFVAGITFANNSMIMEKMVSAIKELQIEVRNIQVASSGIKGTSEELVSKMKANKNDIVKELVKTRDSVLSAMGGILSAPEIEQQPVKTVTIGASQGRRKSTVVPPIEINPELESPVLSKTVSTATPEERIRHEKEKLLADLDWEIGEIAQYTPLIVDFLVPDDILAMAADGLTPELKEKIQNEIIENHIALMALEEYSS",
        "proteome": "UP000008592",
        "gene": "P",
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "27cf93370c186b45ab56708e016cb3800eed4db2",
        "counters": {
            "domain_architectures": 4,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 1,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "cdd": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4
        }
    }
}