General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q936S7",
        "id": "IPUF_PSESP",
        "source_organism": {
            "taxId": "306",
            "scientificName": "Pseudomonas sp.",
            "fullName": "Pseudomonas sp."
        },
        "name": "Gamma-glutamyl-L-1-hydroxyisopropylamide hydrolase",
        "description": [
            "Involved in the degradation of isopropylamine, which is a constituent of the herbicides atrazine. Catalyzes the hydrolysis of gamma-glutamyl-L-alaninol (GALO) to L-alaninol and L-glutamate. It can also uses gamma-glutamyl-isopropylamide, gamma-glutamyl-ethylamide, L-glutamine, and gamma-glutamyl-p-nitroanilide"
        ],
        "length": 295,
        "sequence": "MEKLRILICDGNTEADRASFKKFVGCAPSKQFESLLKNYNSQIRTEIAFPADPGPLMTLPLGAYDGILITGSNSHIYEAQPGNLRQIEFAQKAFASGTPMFGVCWGMQLAVVAAGGEVLPSRVADCSCETPFATGVELTSYGSGHPMHHSRTSGFDVFSFHSDEVTRLPGGAVVTARNRNFIQAVEIKHGRSTFWGVQYHPELSGWDQAGFLRESARSLVEDGSYETLNHVEHAAQAISMFKAGAQISEENLVHFEGVDTNSFEFRPLEILNWLDHLVIPTAKRKFGWGGGWLQK",
        "proteome": null,
        "gene": "ipuF",
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a79a81cdbd2eef5f5e295147e6f92925489d815d",
        "counters": {
            "domain_architectures": 82564,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "profile": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 82564
        }
    }
}