General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q920D3",
        "id": "MED28_MOUSE",
        "source_organism": {
            "taxId": "10090",
            "scientificName": "Mus musculus",
            "fullName": "Mus musculus (Mouse)"
        },
        "name": "Mediator of RNA polymerase II transcription subunit 28",
        "description": [
            "Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. May be part of a complex containing NF2/merlin that participates in cellular signaling to the actin cytoskeleton downstream of tyrosine kinase signaling pathways (By similarity)"
        ],
        "length": 178,
        "sequence": "MAASLGGMFTGQPPGPPPPPPGLPGQASLLQAAPGAPRPSNSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPDQVIKEDVSELRSELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADMPQGSLAFLEQASANIPAPLKQT",
        "proteome": "UP000000589",
        "gene": "Med28",
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5f65a30bbd1e887d747a65588e8f3f64d3306284",
        "counters": {
            "domain_architectures": 2066,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 3,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2066
        }
    }
}