General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q8NBZ7",
        "id": "UXS1_HUMAN",
        "source_organism": {
            "taxId": "9606",
            "scientificName": "Homo sapiens",
            "fullName": "Homo sapiens (Human)"
        },
        "name": "UDP-glucuronic acid decarboxylase 1",
        "description": [
            "Catalyzes the NAD-dependent decarboxylation of UDP-glucuronic acid to UDP-xylose (PubMed:22810237, PubMed:23656592, PubMed:25521717, PubMed:40836090). Necessary for the biosynthesis of the core tetrasaccharide in glycosaminoglycan biosynthesis (PubMed:22810237, PubMed:23656592, PubMed:25521717, PubMed:40836090). Catalyzes the synthesis of UDP-xylose in two steps: the hydroxyl group of UDP-glucuronic acid is first oxidized using an enzyme-bound NAD(+) as electron acceptor, favoring the decarboxylation yielding a UDP-4-ketoxylose reaction intermediate and a reduced cofactor NADH bound to the catalytic pocket (PubMed:22810237, PubMed:40836090). In the second step, the 4-keto group is reduced resulting in UDP-xylose and the restoration of the enzyme to its NAD(+)-bound form (PubMed:22810237, PubMed:40836090)"
        ],
        "length": 420,
        "sequence": "MVSKALLRLVSAVNRRRMKLLLGIALLAYVASVWGNFVNMRSIQENGELKIESKIEEMVEPLREKIRDLEKSFTQKYPPVKFLSEKDRKRILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVYGSGSQTRAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRHS",
        "proteome": "UP000005640",
        "gene": "UXS1",
        "go_terms": [
            {
                "identifier": "GO:0048040",
                "name": "UDP-glucuronate decarboxylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0070403",
                "name": "NAD+ binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0042732",
                "name": "D-xylose metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "26f7b94384e3f210f14d97a0d22ce2fc81be1931",
        "counters": {
            "domain_architectures": 859,
            "entries": 10,
            "isoforms": 3,
            "proteomes": 1,
            "sets": 2,
            "structures": 4,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 2,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 859
        }
    }
}