General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q8K1L2",
        "id": "SPIN4_MOUSE",
        "source_organism": {
            "taxId": "10090",
            "scientificName": "Mus musculus",
            "fullName": "Mus musculus (Mouse)"
        },
        "name": "Spindlin-4",
        "description": [
            "Binds to acetylated and methylated histones, including H3K4me3 and H4K20me3, probably acting as a histone reader that recognizes chromatin marks to mediate downstream cellular effects (By similarity). Promotes canonical WNT signaling, and is involved in the down-regulation of cell proliferation (PubMed:36927955)"
        ],
        "length": 249,
        "sequence": "MSPPTVPPTGVDGVSAYLMKKRHTHKKQRRKPTFLTHRNIVGCRIQHGWKEGNEPVEQWKGTVLEQVSVKPTLYIIKYDGKDSVYGLELHRDKRVLALEILPERVPSPRIDSRLADSLVGKAVGHVFEGEHGKKDEWKGMVLARAPIMDTWFYITYEKDPVLYMYTLLDDYKDGDLRIIPDSNYYFPAAEQEPGEVLDSLVGKQVEHAKDDGSKRTGIFIHQVVAKPSVYFIKFDDDIHIYVYGLVKTP",
        "proteome": "UP000000589",
        "gene": "Spin4",
        "go_terms": [
            {
                "identifier": "GO:0007276",
                "name": "gamete generation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5e6e49d7dd3f0904dc8c37099c937457e905d41d",
        "counters": {
            "domain_architectures": 2191,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2191
        }
    }
}