General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q8AVK2",
        "id": "LN28B_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "Protein lin-28 homolog B",
        "description": [
            "Suppressor of specific microRNA (miRNA) biogenesis. Binds target primary miRNA transcripts and sequester them in the nucleolus, away from the microprocessor complex, hence preventing their processing into mature miRNA. The specific interaction with target pri-miRNAs occurs via an 5'-GGAG-3' motif in the pre-miRNA terminal loop"
        ],
        "length": 252,
        "sequence": "MAEGGAARGTREEQGKLPEQEEEEEEDPQVLLGSGHCKWFNVRMGFGFISMTSREGSPLENPVDVFVHQSKLYMDGFRSLKEGEPVEFTFKKSSKGFESLRVTGPGGNPCLGSERRPKAKTVQKRKPKGDRCYNCGGLDHHAKECNLPPQPKKCHYCQSTMHMVANCPHKIVPQHPTTSQGRYEAEPQPSTSSFQREGGGAFDYSSPSYSQEGRSELSERSSRSPQEASLSKISTSPEEQSRKGPSVQKKKK",
        "proteome": "UP000186698",
        "gene": "lin28b",
        "go_terms": [
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e463dd08e587623638bfc1bf10974183cd3819aa",
        "counters": {
            "domain_architectures": 1860,
            "entries": 21,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "profile": 2,
                "ssf": 2,
                "smart": 2,
                "cdd": 1,
                "pfam": 3,
                "panther": 1,
                "prints": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1860
        }
    }
}