General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q6GH30",
        "id": "FEMB_STAAR",
        "source_organism": {
            "taxId": "282458",
            "scientificName": "Staphylococcus aureus (strain MRSA252)",
            "fullName": "Staphylococcus aureus (strain MRSA252)"
        },
        "name": "Aminoacyltransferase FemB",
        "description": [
            "Catalyzes the formation of the pentaglycine interpeptide bridge, which is characteristic of the S.aureus peptidoglycan. Adds glycines 4 and 5 of the pentaglycine bridge, using glycyl-tRNA(Gly) as donor. Involved in resistance to methicillin (By similarity)"
        ],
        "length": 419,
        "sequence": "MKFTELTVTEFDNFVQNPSLESHYFQVKENIVTRENDGFEVVLLGIKDDNNKVIAASLFSKIPTMGSYVYYSNRGPVMDFSDLGLVDYYLKELDKYLQQHQCLYVKLDPYWLYHLYDKDIVPFEGREKNDALVNLFKSHGYEHHGFTTEYDTSSQVRWMGVLNLEGKTPETLKKTFDSQRKRNINKAINYGVKVRFLERDEFNLFLDLYRETEERAGFVSKTDDYFYNFIDTYGDKVLVPLAYIDLDEYVLKLQQELNDKENRRDQMMAKENKSDKQMKKIAELDKQIDHDQHELLNASELSKTDGPILNLASGVYFANAYEVNYFSGGSSEKYNQFMGPYMMHWFMINYCFDNGYDRYNFYGLSGDFTENSEDYGVYRFKRGFNVQIEELIGDFYKPIHKVKYWLFTTLDKLRKKLKK",
        "proteome": null,
        "gene": "femB",
        "go_terms": [
            {
                "identifier": "GO:0016755",
                "name": "aminoacyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0044038",
                "name": "cell wall macromolecule biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fa5b73be9082afcd2ebf6a46b30b190e5cf0be63",
        "counters": {
            "domain_architectures": 3766,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "profile": 1,
                "cathgene3d": 2,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 3766
        }
    }
}