General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q66IM1",
        "id": "SGMR1_XENTR",
        "source_organism": {
            "taxId": "8364",
            "scientificName": "Xenopus tropicalis",
            "fullName": "Xenopus tropicalis (Western clawed frog)"
        },
        "name": "Sigma non-opioid intracellular receptor 1",
        "description": [
            "May function in lipid transport from the endoplasmic reticulum and be involved in a wide array of cellular functions probably through regulation of the biogenesis of lipid microdomains at the plasma membrane. May regulate calcium efflux at the endoplasmic reticulum (By similarity)"
        ],
        "length": 221,
        "sequence": "MALWRGLRAVLAVAGLAVAVQLLRGWLGSKSYVFNREEIARLAKEHSGLDYEVAFSKIITELRKKHPGRILPDEDLQWVFVNAGGWMGSMCLLHASLTEYVLLFGTAVDTSGHSGRYWAEISDTILSGTFRQWKEGSTKSEIFYPGDTIVHEVGEATSVQWSAGTWMVEYGRGFIPSTLGFALADTIFSTQDFLTLFYTVKVYGKALLLETSTHLSELGFF",
        "proteome": "UP000008143",
        "gene": "sigmar1",
        "go_terms": null,
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fa26940a01da7164d0d08c08b4cab1df03e2d311",
        "counters": {
            "domain_architectures": 3266,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3266
        }
    }
}