HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q5Y4Y9",
"id": "T2R64_PANPA",
"source_organism": {
"taxId": "9597",
"scientificName": "Pan paniscus",
"fullName": "Pan paniscus (Pygmy chimpanzee)"
},
"name": "Taste receptor type 2 member 64",
"description": [
"Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5 (By similarity)"
],
"length": 309,
"sequence": "MVYFLLIILSILVVFAFVLGNFSNGFVALVNVIDWVKTRKISSADQILTALVVSRIGLLWVILFHWYANVFNSALYSSEVGAVASNISAIINHFSIWLAASLGIFYLLKIANFSNLIFLHLKKRIRSVVLVILLGPLVFLICNLAVITMDERVWTKEYEGNVTWKIKLRNAIHLSDLTVSTLANLIPFILTLICFLLLICSLHKHLKKMQLHGKGSQDLSTKVHIKALQTVISFLMLYAIYFLYLITLTWNLWTQQNKLVFLLCQTLGIMYPSFHSFFLIMGSRKLKQTFLSVLCQVTCLVKGQQPSTP",
"proteome": "UP000240080",
"gene": "TAS2R64",
"go_terms": [
{
"identifier": "GO:0004930",
"name": "G protein-coupled receptor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0033038",
"name": "bitter taste receptor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0007186",
"name": "G protein-coupled receptor signaling pathway",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0050909",
"name": "sensory perception of taste",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ccf1a00abd131ef78ff2e93d3e192bba178713b7",
"counters": {
"domain_architectures": 6687,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 6687
}
}
}