General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q5JEV0",
        "id": "RS32_THEKO",
        "source_organism": {
            "taxId": "69014",
            "scientificName": "Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)",
            "fullName": "Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)"
        },
        "name": "Small ribosomal subunit protein eS32",
        "description": [
            "Interacts with N(4)-acetylcytidine (ac(4)C) 1459 of the small rRNA; the acetyl group of ac(4)C1459 briges the interaction with this protein"
        ],
        "length": 37,
        "sequence": "MKRRPRKWKKKGRMRWKWIKKRIRRLKRQRRKERGLI",
        "proteome": "UP000000536",
        "gene": "rpl41e",
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 0,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 3,
            "taxa": 1,
            "dbEntries": {},
            "proteome": 1,
            "taxonomy": 1
        }
    }
}