GET /api/protein/reviewed/Q51787/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q51787",
"id": "PHZA_PSEFL",
"source_organism": {
"taxId": "294",
"scientificName": "Pseudomonas fluorescens",
"fullName": "Pseudomonas fluorescens"
},
"name": "Phenazine biosynthesis protein PhzA",
"description": [
"Involved in the biosynthesis of the antibiotic, phenazine, a nitrogen-containing heterocyclic molecule having important roles in virulence, competition and biological control"
],
"length": 163,
"sequence": "MPGSLSSGGFNDHLELRRKNRATVDQYMRTNGEDRLRRHELFTPDGSGGSWNTETGEPLVFKGHAKLAALGVWLHQCFPDWQWHNVRVFETDNPNHFWVESDGRGTTRVPGYPEGYCENHYIHSFELDNGKITQNREFMNPFEQLRALGIPVPKIKREGIPAS",
"proteome": null,
"gene": "phzA",
"go_terms": [
{
"identifier": "GO:0017000",
"name": "antibiotic biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "2d329f9f8de1ac040f17b373a04a0b54708d5bfb",
"counters": {
"domain_architectures": 438,
"entries": 5,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"cathgene3d": 1,
"ssf": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 438
}
}
}