GET /api/protein/reviewed/Q4FNV6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q4FNV6",
"id": "TSAD_PELUB",
"source_organism": {
"taxId": "335992",
"scientificName": "Pelagibacter ubique (strain HTCC1062)",
"fullName": "Pelagibacter ubique (strain HTCC1062)"
},
"name": "tRNA N6-adenosine threonylcarbamoyltransferase",
"description": [
"Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37, together with TsaE and TsaB. TsaD likely plays a direct catalytic role in this reaction"
],
"length": 357,
"sequence": "MNKKPIILGIESSCDETAASIITENEQGMPTILSSIVSSQVDVHKEFGGVVPELAARSHMEKIDLITKKAFDKSGVKMEDLDAIAATAGPGLMVCLSVGLSFGKAMASSLNKPFIAVNHLEGHALSPKLNSELNYPYLLLLISGGHTQFLSVQGLGNYKRLGTTIDDAVGEAFDKTAKLLGIEFPGGPQIEVYAKKGDPNKYELPKPIFHKGGCNLSFAGLKTAVLKISKQIKTEQEKYDLAASFQKTIEEILYKKSKIAFEEFKKMNTINKNKFVVAGGVAANKRIREVLTNLCKEEEFEAIFPPINLCGDNAAMIAMVGLEKFKLKQFSELDSPAKPRWPLDADAAFLKGAGVRL",
"proteome": "UP000002528",
"gene": "tsaD",
"go_terms": [
{
"identifier": "GO:0002949",
"name": "tRNA threonylcarbamoyladenosine modification",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7b9abc2a1639562e73a52cbc6da89a4b5eb7adec",
"counters": {
"domain_architectures": 61776,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 2,
"pfam": 1,
"prints": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 61776
}
}
}