GET /api/protein/reviewed/Q39258/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q39258",
        "id": "VATE1_ARATH",
        "source_organism": {
            "taxId": "3702",
            "scientificName": "Arabidopsis thaliana",
            "fullName": "Arabidopsis thaliana (Mouse-ear cress)"
        },
        "name": "V-type proton ATPase subunit E1",
        "description": [
            "Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. Required for Golgi organization and vacuole function in embryogenesis"
        ],
        "length": 230,
        "sequence": "MNDGDVSRQIQQMVRFIRQEAEEKANEISVSAEEEFNIEKLQLVEAEKKKIRQDYEKKEKQADVRKKIDYSMQLNASRIKVLQAQDDIVNAMKDQAAKDLLNVSRDEYAYKQLLKDLIVQCLLRLKEPSVLLRCREEDLGLVEAVLDDAKEEYAGKAKVHAPEVAVDTKIFLPPPPKSNDPHGLHCSGGVVLASRDGKIVCENTLDARLDVAFRMKLPVIRKSLFGQVTA",
        "proteome": "UP000006548",
        "gene": "VHA-E1",
        "go_terms": [
            {
                "identifier": "GO:0046961",
                "name": "proton-transporting ATPase activity, rotational mechanism",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:1902600",
                "name": "proton transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0033178",
                "name": "proton-transporting two-sector ATPase complex, catalytic domain",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ff14d66dcb337bc5537664e75be4de3987e85edf",
        "counters": {
            "domain_architectures": 8892,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "panther": 1,
                "hamap": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 8892
        }
    }
}