GET /api/protein/reviewed/Q2JV29/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q2JV29",
        "id": "CCSA_SYNJA",
        "source_organism": {
            "taxId": "321327",
            "scientificName": "Synechococcus sp. (strain JA-3-3Ab)",
            "fullName": "Synechococcus sp. (strain JA-3-3Ab)"
        },
        "name": "Cytochrome c biogenesis protein CcsA",
        "description": [
            "Required during biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f) at the step of heme attachment"
        ],
        "length": 344,
        "sequence": "MLAITALAGLDLAQWQALLNNVAFAVCLGAMLFYWGGAAFPQVQLLSELGLAGMIGANLTIAALLTARWIDAGYFPLSNLYESLFFLAWGITALHLLALHWTRSRWVGVTTAPLATGVVAFAALALPADMQEAQPLVPALQSNWLMMHVTVMLLAYAALLVGSLLAIAFLIVTRGQEVQLKGNSLGLQFGPSQPATHPEWTEATLPSPAAELVYAGIRSPRPAEPPPQPAPEGIPLQRLSLAEILDNTSYRLIGLGFPLLTIGIIAGAVWANEAWGTYWSWDPKETWALITWLVFAAYLHARITKGWQGKRPALLASLGFGVVWVCYLGVNFLGKGLHSYGWFF",
        "proteome": null,
        "gene": "ccsA",
        "go_terms": [
            {
                "identifier": "GO:0017004",
                "name": "cytochrome complex assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0020037",
                "name": "heme binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e67c2ecfc6eb277295698b6bd35a6d4d4ec1e449",
        "counters": {
            "domain_architectures": 39206,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 39206
        }
    }
}