GET /api/protein/reviewed/Q2JV29/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q2JV29",
"id": "CCSA_SYNJA",
"source_organism": {
"taxId": "321327",
"scientificName": "Synechococcus sp. (strain JA-3-3Ab)",
"fullName": "Synechococcus sp. (strain JA-3-3Ab)"
},
"name": "Cytochrome c biogenesis protein CcsA",
"description": [
"Required during biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f) at the step of heme attachment"
],
"length": 344,
"sequence": "MLAITALAGLDLAQWQALLNNVAFAVCLGAMLFYWGGAAFPQVQLLSELGLAGMIGANLTIAALLTARWIDAGYFPLSNLYESLFFLAWGITALHLLALHWTRSRWVGVTTAPLATGVVAFAALALPADMQEAQPLVPALQSNWLMMHVTVMLLAYAALLVGSLLAIAFLIVTRGQEVQLKGNSLGLQFGPSQPATHPEWTEATLPSPAAELVYAGIRSPRPAEPPPQPAPEGIPLQRLSLAEILDNTSYRLIGLGFPLLTIGIIAGAVWANEAWGTYWSWDPKETWALITWLVFAAYLHARITKGWQGKRPALLASLGFGVVWVCYLGVNFLGKGLHSYGWFF",
"proteome": null,
"gene": "ccsA",
"go_terms": [
{
"identifier": "GO:0017004",
"name": "cytochrome complex assembly",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0020037",
"name": "heme binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e67c2ecfc6eb277295698b6bd35a6d4d4ec1e449",
"counters": {
"domain_architectures": 39206,
"entries": 7,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"hamap": 1,
"panther": 1,
"ncbifam": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 39206
}
}
}