General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P69161",
        "id": "SOMA_PANPG",
        "source_organism": {
            "taxId": "8001",
            "scientificName": "Pangasius pangasius",
            "fullName": "Pangasius pangasius (Yellowtail catfish)"
        },
        "name": "Somatotropin",
        "description": [
            "Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation"
        ],
        "length": 200,
        "sequence": "MARVLVVLSVVVASLFFSQGATFENQRLFNNAVIRVQHLHQLAAKMMDDFEEALLPEERKQLSKIFPLSFCNSDSIEAPAGKDETQKSSVLKLLHTSYRLIESWEFPSKNLGNPNHISEKLADLKMGIGVLIEGCLDGQTSLDENDSLAPPFEDFYQTLSEGNLRKSFRLLSCFKKDMHKVETYLSVAKCRRSLDSNCTL",
        "proteome": null,
        "gene": "gh",
        "go_terms": [
            {
                "identifier": "GO:0005179",
                "name": "hormone activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0005131",
                "name": "growth hormone receptor binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005615",
                "name": "extracellular space",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d466c05a6c5d2269669bb799ef8b087ee7e11dac",
        "counters": {
            "domain_architectures": 5872,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "prosite": 2,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 5872
        }
    }
}