General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P69156",
        "id": "MCH2_ONCTS",
        "source_organism": {
            "taxId": "74940",
            "scientificName": "Oncorhynchus tshawytscha",
            "fullName": "Oncorhynchus tshawytscha (Chinook salmon)"
        },
        "name": "Pro-MCH 2",
        "description": [
            "Plays a role in skin pigmentation by antagonizing the action of melanotropin alpha. Induces melanin concentration within the melanophores. May participate in the control of the hypothalamo-pituitary adrenal gland axis by inhibiting the release of ACTH"
        ],
        "length": 132,
        "sequence": "MRDSVLSVIFALALFLECYTPSMAIPMGKMEDTALEQDTLDSLLNEEVADKNPDSVRSGSSKIIVLADSGMWKNLNRGLPLYKLKAAAAGLDRALTLDRREADQDLSPSISIVRRDTMRCMVGRVYRPCWEV",
        "proteome": "UP000694402",
        "gene": "mch2",
        "go_terms": [
            {
                "identifier": "GO:0030354",
                "name": "melanin-concentrating hormone activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0007268",
                "name": "chemical synaptic transmission",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "eb09a978f5bc7f46720a7b729af620b40018fad0",
        "counters": {
            "domain_architectures": 903,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "prints": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 903
        }
    }
}