General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P54616",
        "id": "FABI_BACSU",
        "source_organism": {
            "taxId": "224308",
            "scientificName": "Bacillus subtilis (strain 168)",
            "fullName": "Bacillus subtilis (strain 168)"
        },
        "name": "Enoyl-[acyl-carrier-protein] reductase [NADH] FabI",
        "description": [
            "Catalyzes the reduction of a carbon-carbon double bond in an enoyl moiety that is covalently linked to an acyl carrier protein (ACP). Involved in the elongation cycle of fatty acid which are used in the lipid metabolism"
        ],
        "length": 258,
        "sequence": "MNFSLEGRNIVVMGVANKRSIAWGIARSLHEAGARLIFTYAGERLEKSVHELAGTLDRNDSIILPCDVTNDAEIETCFASIKEQVGVIHGIAHCIAFANKEELVGEYLNTNRDGFLLAHNISSYSLTAVVKAARPMMTEGGSIVTLTYLGGELVMPNYNVMGVAKASLDASVKYLAADLGKENIRVNSISAGPIRTLSAKGISDFNSILKDIEERAPLRRTTTPEEVGDTAAFLFSDMSRGITGENLHVDSGFHITAR",
        "proteome": "UP000001570",
        "gene": "fabI",
        "go_terms": [
            {
                "identifier": "GO:0004318",
                "name": "enoyl-[acyl-carrier-protein] reductase (NADH) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006633",
                "name": "fatty acid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ff1cec7cb7eee88f7c3ec2b2277c3a1762c3bf68",
        "counters": {
            "domain_architectures": 518272,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 2,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "ncbifam": 1,
                "panther": 1,
                "pirsf": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 518272
        }
    }
}