General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P0ADV1",
        "id": "LPTA_ECOLI",
        "source_organism": {
            "taxId": "83333",
            "scientificName": "Escherichia coli (strain K12)",
            "fullName": "Escherichia coli (strain K12)"
        },
        "name": "Lipopolysaccharide export system protein LptA",
        "description": [
            "Involved in the assembly of lipopolysaccharide (LPS). Required for the translocation of LPS from the inner membrane to the outer membrane. May form a bridge between the inner membrane and the outer membrane, via interactions with LptC and LptD, thereby facilitating LPS transfer across the periplasm"
        ],
        "length": 185,
        "sequence": "MKFKTNKLSLNLVLASSLLAASIPAFAVTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPSQLQDKNNKGQTPAQKKGN",
        "proteome": "UP000000625",
        "gene": "lptA",
        "go_terms": [
            {
                "identifier": "GO:0001530",
                "name": "lipopolysaccharide binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015920",
                "name": "lipopolysaccharide transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0042597",
                "name": "periplasmic space",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fd40c275e518841f234ef575cc4f55ae7b4fa573",
        "counters": {
            "domain_architectures": 10995,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 9,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "ncbifam": 2,
                "panther": 1,
                "hamap": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 10995
        }
    }
}