General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P0ABN6",
        "id": "DCUA_ECOL6",
        "source_organism": {
            "taxId": "199310",
            "scientificName": "Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)",
            "fullName": "Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)"
        },
        "name": "C4-dicarboxylate transporter DcuA",
        "description": [
            "Responsible for the transport of C4-dicarboxylates during aerobic and anaerobic growth. Required for the uptake of L-aspartate as a nitrogen source during aerobic growth. The uptake of L-aspartate in aerobic conditions is coupled to the excretion of fumarate, resulting in the net uptake of nitrogen without carbon uptake. In addition, during anaerobic growth, catalyzes the uptake of fumarate, malate or aspartate coupled to the export of succinate. May play a a general role in anaerobic C4-dicarboxylate transport"
        ],
        "length": 433,
        "sequence": "MLVVELIIVLLAIFLGARLGGIGIGFAGGLGVLVLAAIGVKPGNIPFDVISIIMAVIAAISAMQVAGGLDYLVHQTEKLLRRNPKYITILAPIVTYFLTIFAGTGNISLATLPVIAEVAKEQGVKPCRPLSTAVVSAQIAITASPISAAVVYMSSVMEGHGISYLHLLSVVIPSTLLAVLVMSFLVTMLFNSKLSDDPIYRKRLEEGLVELRGEKQIEIKSGAKTSVWLFLLGVVGVVIYAIINSPSMGLVEKPLMNTTNAILIIMLSVATLTTVICKVDTDNILNSSTFKAGMSACICILGVAWLGDTFVSNNIDWIKDTAGEVIQGHPWLLAVIFFFASALLYSQAATAKALMPMALALNVSPLTAVASFAAVSGLFILPTYPTLVAAVQMDDTGTTRIGKFVFNHPFFIPGTLGVALAVCFGFVLGSFML",
        "proteome": "UP000001410",
        "gene": "dcuA",
        "go_terms": [
            {
                "identifier": "GO:0015556",
                "name": "C4-dicarboxylate transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015740",
                "name": "C4-dicarboxylate transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a55cecbce315de820975bea2e4f0bafbc4165e2f",
        "counters": {
            "domain_architectures": 6480,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pirsf": 1,
                "ncbifam": 3,
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 6480
        }
    }
}