HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "P0A6X7",
"id": "IHFA_ECOLI",
"source_organism": {
"taxId": "83333",
"scientificName": "Escherichia coli (strain K12)",
"fullName": "Escherichia coli (strain K12)"
},
"name": "Integration host factor subunit alpha",
"description": [
"One of the 2 subunits of integration host factor (IHF), a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control. Binds to hundreds of transcriptionally inactive, AT-rich DNA sites, approximately half its binding sites are in non-coding DNA, which only accounts for about 10% of the genome (PubMed:16963779). IHF in combination with the datA locus promotes ATP hydrolysis of ATP-DnaA, called DDAH (datA-dependent DnaA-ATP hydrolysis) (PubMed:23277577). IHF binds oriC as replication initiates, dissociates within minutes and slowly reassociates during the cell cyle; IHF binding to datA is low before initiation, rises after initiation and dissociates during the cell cycle, allowing IHF to coordinate replication initiation (PubMed:23277577)",
"Plays a crucial role in the lysogenic life cycle of bacteriophage lambda, as it is required not only in the recombination reaction, which inserts lambda DNA into the E.coli chromosome, but also for the synthesis of int and cI repressor, two phage proteins necessary for DNA insertion and repression, respectively. The synthesis of int and cI proteins is regulated indirectly by IHF via translational control of the lambda cII protein",
"Has an essential role in conjugative DNA transfer (CDT), the unidirectional transfer of ssDNA plasmid from a donor to a recipient cell. It is the central mechanism by which antibiotic resistance and virulence factors are propagated in bacterial populations. Part of the relaxosome, which facilitates a site- and strand-specific cut in the origin of transfer by TraI, at the nic site. Relaxosome formation requires binding of IHF and TraY to the oriT region, which then facilitates binding of TraI (PubMed:7499339, PubMed:7499340)"
],
"length": 99,
"sequence": "MALTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIPITARRVVTFRPGQKLKSRVENASPKDE",
"proteome": "UP000000625",
"gene": "ihfA",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0030527",
"name": "structural constituent of chromatin",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006310",
"name": "DNA recombination",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "69cfcabeafc3186618e3c95978399e9c6cf3360d",
"counters": {
"domain_architectures": 61377,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 15,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 1,
"smart": 1,
"ssf": 1,
"cdd": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 2,
"prints": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 61377
}
}
}