General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P02886",
        "id": "DIS1A_DICDI",
        "source_organism": {
            "taxId": "44689",
            "scientificName": "Dictyostelium discoideum",
            "fullName": "Dictyostelium discoideum (Social amoeba)"
        },
        "name": "Discoidin-1 subunit A",
        "description": [
            "Galactose- and N-acetylgalactosamine-binding lectin. May play a role in cell-substratum adhesion rather than in cell-cell adhesion. May be necessary for the maintenance of normal elongate morphology during aggregation"
        ],
        "length": 253,
        "sequence": "MSTQGLVQLLANAQCHLRTSTNYNGVHTQFNSALNYKNNGTNTIDGSEAWCSSIVDTNQYIVAGCEVPRTFMCVALQGRGDADQWVTSYKIRYSLDNVSWFEYRNGAAVTGVTDRNTVVNHFFDTPIRARSIAIHPLTWNGHISLRCEFYTQPVQSSVTQVGADIYTGDNCALNTGSGKREVVVPVKFQFEFATLPKVALNFDQIDCTDATNQTRIGVQPRNITTKGFDCVFYTWNENKVYSLRADYIATALE",
        "proteome": "UP000002195",
        "gene": "dscA-1",
        "go_terms": [
            {
                "identifier": "GO:0030246",
                "name": "carbohydrate binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0007155",
                "name": "cell adhesion",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4c3a4da9d5cc484d48ba37b625ea819a24ba851d",
        "counters": {
            "domain_architectures": 49,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 4,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "cathgene3d": 2,
                "pfam": 2,
                "ssf": 2,
                "cdd": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 49
        }
    }
}