General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P00929",
        "id": "TRPA_SALTY",
        "source_organism": {
            "taxId": "99287",
            "scientificName": "Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)",
            "fullName": "Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)"
        },
        "name": "Tryptophan synthase alpha chain",
        "description": [
            "The alpha subunit is responsible for the aldol cleavage of indoleglycerol phosphate to indole and glyceraldehyde 3-phosphate"
        ],
        "length": 268,
        "sequence": "MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA",
        "proteome": "UP000001014",
        "gene": "trpA",
        "go_terms": [
            {
                "identifier": "GO:0004834",
                "name": "tryptophan synthase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006568",
                "name": "L-tryptophan metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b4d61cd7421b9af8f1b1f6828ab2d7db960d1f4b",
        "counters": {
            "domain_architectures": 26779,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 131,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 1,
                "hamap": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 26779
        }
    }
}