GET /api/protein/reviewed/P00798/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "P00798",
"id": "PEPA1_PENJA",
"source_organism": {
"taxId": "5079",
"scientificName": "Penicillium janthinellum",
"fullName": "Penicillium janthinellum"
},
"name": "Penicillopepsin-1",
"description": [
"Secreted aspartic endopeptidase that allows assimilation of proteinaceous substrates. The scissile peptide bond is attacked by a nucleophilic water molecule activated by two aspartic residues in the active site. Shows a broad primary substrate specificity. Favors hydrophobic residues at the P1 and P1' positions, but can also activate trypsinogen and hydrolyze the B chain of insulin between positions 'Gly-20' and 'Glu-21'"
],
"length": 323,
"sequence": "AASGVATNTPTANDEEYITPVTIGGTTLNLNFDTGSADLWVFSTELPASQQSGHSVYNPSATGKELSGYTWSISYGDGSSASGNVFTDSVTVGGVTAHGQAVQAAQQISAQFQQDTNNDGLLGLAFSSINTVQPQSQTTFFDTVKSSLAQPLFAVALKHQQPGVYDFGFIDSSKYTGSLTYTGVDNSQGFWSFNVDSYTAGSQSGDGFSGIADTGTTLLLLDDSVVSQYYSQVSGAQQDSNAGGYVFDCSTNLPDFSVSISGYTATVPGSLINYGPSGDGSTCLGGIQSNSGIGFSIFGDIFLKSQYVVFDSDGPQLGFAPQA",
"proteome": null,
"gene": null,
"go_terms": [
{
"identifier": "GO:0004190",
"name": "aspartic-type endopeptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006508",
"name": "proteolysis",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4f7e38ba910b0f25f406cea3df5f8e462e02113f",
"counters": {
"domain_architectures": 46498,
"entries": 13,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 14,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"profile": 1,
"cdd": 1,
"panther": 1,
"prosite": 1,
"prints": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 46498
}
}
}