GET /api/protein/reviewed/O05412/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "O05412",
        "id": "MURI2_BACSU",
        "source_organism": {
            "taxId": "224308",
            "scientificName": "Bacillus subtilis (strain 168)",
            "fullName": "Bacillus subtilis (strain 168)"
        },
        "name": "Glutamate racemase 2",
        "description": [
            "Provides the (R)-glutamate required for cell wall biosynthesis"
        ],
        "length": 265,
        "sequence": "MKIGFFDSGIGGMTVLYEAIKVLPYEDYIFYADTLNVPYGEKSKGKVKEYIFNAAEFLASQNIKALVIACNTATSIAIEDLRRNFDFPIIGIEPAVKPAINKCTEERKRVLVVATNLTLKEEKFHNLVKEIDHHDLVDCLALPGLVEFAENFDFSEDKIIKYLKNELSSFDLKQYGTIVLGCTHFPFFKNSFEKLFGIKVDMISGSVGTAKQLKKVLADRNQLGKGSGSITFFNSGHKIVDQEVISKYKRLFEILDETQRSHVGH",
        "proteome": "UP000001570",
        "gene": "yrpC",
        "go_terms": [
            {
                "identifier": "GO:0016855",
                "name": "racemase and epimerase activity, acting on amino acids and derivatives",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008881",
                "name": "glutamate racemase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0047661",
                "name": "amino-acid racemase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "70fb0a71e032450802e3e5635757ed8dffe63f15",
        "counters": {
            "domain_architectures": 52737,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "pfam": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 52737
        }
    }
}