GET /api/protein/reviewed/B8E7F3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B8E7F3",
        "id": "IHFA_SHEB2",
        "source_organism": {
            "taxId": "407976",
            "scientificName": "Shewanella baltica (strain OS223)",
            "fullName": "Shewanella baltica (strain OS223)"
        },
        "name": "Integration host factor subunit alpha",
        "description": [
            "This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control"
        ],
        "length": 98,
        "sequence": "MALTKAEMAEHLFETLGMNKRVAKEMVESFFEEIRGALESGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIPISARRVVTFRPGQKLKTRVEAANTGK",
        "proteome": null,
        "gene": "ihfA",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0030527",
                "name": "structural constituent of chromatin",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006310",
                "name": "DNA recombination",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "69cfcabeafc3186618e3c95978399e9c6cf3360d",
        "counters": {
            "domain_architectures": 61377,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "smart": 1,
                "ssf": 1,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 2,
                "hamap": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 61377
        }
    }
}