GET /api/protein/reviewed/B1XMM7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B1XMM7",
"id": "CPCV_PICP2",
"source_organism": {
"taxId": "32049",
"scientificName": "Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)",
"fullName": "Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)"
},
"name": "Putative chromophore lyase CpcV",
"description": [
"Covalently attaches a chromophore to Cys residue(s) of phycobiliproteins"
],
"length": 202,
"sequence": "MPCPGLQENVTIYKLSIDICRSSRSSSPMNLLATSPSASTAFFQRSAGRWHSQRRYYTLNSDQEPLEAISAIEVVFLPAEHPHLKPLAIAHHLSPDQAFQCGAKVTWESTYTNVQRKPLKGETIFGIRDQLMYRDRGFSTTAPIVAEFELIQPHVMRLQTAYDGASFEEEIKFVGDKHRTRQTITSRAGQELMIAQYLETRL",
"proteome": null,
"gene": "cpcV",
"go_terms": [
{
"identifier": "GO:0017009",
"name": "protein-phycocyanobilin linkage",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b066bf5156d51333fe3e2257e3f7878de50b32bc",
"counters": {
"domain_architectures": 1259,
"entries": 6,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"pfam": 1,
"hamap": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 1259
}
}
}