GET /api/protein/reviewed/B1XMM7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B1XMM7",
        "id": "CPCV_PICP2",
        "source_organism": {
            "taxId": "32049",
            "scientificName": "Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)",
            "fullName": "Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)"
        },
        "name": "Putative chromophore lyase CpcV",
        "description": [
            "Covalently attaches a chromophore to Cys residue(s) of phycobiliproteins"
        ],
        "length": 202,
        "sequence": "MPCPGLQENVTIYKLSIDICRSSRSSSPMNLLATSPSASTAFFQRSAGRWHSQRRYYTLNSDQEPLEAISAIEVVFLPAEHPHLKPLAIAHHLSPDQAFQCGAKVTWESTYTNVQRKPLKGETIFGIRDQLMYRDRGFSTTAPIVAEFELIQPHVMRLQTAYDGASFEEEIKFVGDKHRTRQTITSRAGQELMIAQYLETRL",
        "proteome": null,
        "gene": "cpcV",
        "go_terms": [
            {
                "identifier": "GO:0017009",
                "name": "protein-phycocyanobilin linkage",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b066bf5156d51333fe3e2257e3f7878de50b32bc",
        "counters": {
            "domain_architectures": 1259,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 1,
                "hamap": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 1259
        }
    }
}