GET /api/protein/reviewed/A9ISM8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A9ISM8",
        "id": "LPXA_BART1",
        "source_organism": {
            "taxId": "382640",
            "scientificName": "Bartonella tribocorum (strain DSM 28219 / CCUG 45778 / CIP 105476 / IBS 506)",
            "fullName": "Bartonella tribocorum (strain DSM 28219 / CCUG 45778 / CIP 105476 / IBS 506)"
        },
        "name": "Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase",
        "description": [
            "Involved in the biosynthesis of lipid A, a phosphorylated glycolipid that anchors the lipopolysaccharide to the outer membrane of the cell"
        ],
        "length": 270,
        "sequence": "MSGTKIHPTALVEKGAQLGENVRVGPFCHISSEAVIGDECSLTSHVVIMGKTMLGAKSKVFSHAVLGADPQNNKHKGGATILSIGKNCMIREGVTMHRGSDSSTGMTVVGDNCQFFCYAHIAHDCHVGNHVTFANNAMIAGHVTVGDYVIIGGGAAVHQFVRVGHHAFIGGVSALVGDLIPYGTAVGVQAKLAGLNIIGMKRAGLERQDIHALRHAVAMLFDHSKPFKERVNDVASCYSSSRSVADVVRFIKEEGKRFYCTPKFGGDRIK",
        "proteome": "UP000001592",
        "gene": "lpxA",
        "go_terms": [
            {
                "identifier": "GO:0008780",
                "name": "acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008610",
                "name": "lipid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "04017e3a0e3ed45a37a3eb40f295de77623fcd52",
        "counters": {
            "domain_architectures": 8032,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "cdd": 1,
                "pfam": 2,
                "panther": 1,
                "ncbifam": 2,
                "hamap": 1,
                "pirsf": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 8032
        }
    }
}