GET /api/protein/reviewed/A9ISM8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A9ISM8",
"id": "LPXA_BART1",
"source_organism": {
"taxId": "382640",
"scientificName": "Bartonella tribocorum (strain DSM 28219 / CCUG 45778 / CIP 105476 / IBS 506)",
"fullName": "Bartonella tribocorum (strain DSM 28219 / CCUG 45778 / CIP 105476 / IBS 506)"
},
"name": "Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase",
"description": [
"Involved in the biosynthesis of lipid A, a phosphorylated glycolipid that anchors the lipopolysaccharide to the outer membrane of the cell"
],
"length": 270,
"sequence": "MSGTKIHPTALVEKGAQLGENVRVGPFCHISSEAVIGDECSLTSHVVIMGKTMLGAKSKVFSHAVLGADPQNNKHKGGATILSIGKNCMIREGVTMHRGSDSSTGMTVVGDNCQFFCYAHIAHDCHVGNHVTFANNAMIAGHVTVGDYVIIGGGAAVHQFVRVGHHAFIGGVSALVGDLIPYGTAVGVQAKLAGLNIIGMKRAGLERQDIHALRHAVAMLFDHSKPFKERVNDVASCYSSSRSVADVVRFIKEEGKRFYCTPKFGGDRIK",
"proteome": "UP000001592",
"gene": "lpxA",
"go_terms": [
{
"identifier": "GO:0008780",
"name": "acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008610",
"name": "lipid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "04017e3a0e3ed45a37a3eb40f295de77623fcd52",
"counters": {
"domain_architectures": 8032,
"entries": 16,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"cdd": 1,
"pfam": 2,
"panther": 1,
"ncbifam": 2,
"hamap": 1,
"pirsf": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 8032
}
}
}