General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A8HDJ7",
        "id": "3S11_CRYNI",
        "source_organism": {
            "taxId": "292442",
            "scientificName": "Cryptophis nigrescens",
            "fullName": "Cryptophis nigrescens (Eastern small-eyed snake)"
        },
        "name": "Short neurotoxin 1",
        "description": [
            "Binds to muscle nicotinic acetylcholine receptor (nAChR) and inhibit acetylcholine from binding to the receptor, thereby impairing neuromuscular transmission"
        ],
        "length": 81,
        "sequence": "MKTLLLTLVVVTIVCLDLGYTMTCCNQQSSQPKTITTCAESSCYKKTWKDHHGTRIERGCGCPPRKPLIDLICCETDECNN",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0090729",
                "name": "toxin activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "10613baefee846b965eb5d8c372010bce9e3d092",
        "counters": {
            "domain_architectures": 1097,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 1097
        }
    }
}