General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "X8CF58",
        "id": "X8CF58_MYCIT",
        "source_organism": {
            "taxId": "1299331",
            "scientificName": "Mycobacterium intracellulare 1956",
            "fullName": "Mycobacterium intracellulare 1956"
        },
        "name": "Lysine N-acyltransferase MbtK",
        "description": [
            "Acyltransferase required for the direct transfer of medium- to long-chain fatty acyl moieties from a carrier protein (MbtL) on to the epsilon-amino group of lysine residue in the mycobactin core"
        ],
        "length": 195,
        "sequence": "MLARELTDITDSVRQVPAPPVPELLPPSRIRVADPDGADAELVAEWMNRPHLVTTWEYDWPVARWRNHLRAQVDGAYSRPLILSINGVDRAYMEIYRAAKDSIARCYDSRPHDLGLHGAIADEELVNRGLGPLILRKVIASILAADPACQRIMFDPDHRNTTVRRLCEFLRCEFLGEHDMPNRRMALYALNRPAP",
        "proteome": null,
        "gene": "I550_5719",
        "go_terms": [
            {
                "identifier": "GO:0016746",
                "name": "acyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019290",
                "name": "siderophore biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7e5565f8f14570da06b4c2ac930e5c23590c7ceb",
        "counters": {
            "domain_architectures": 12282,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 12282
        }
    }
}