GET /api/protein/UniProt/X5IDN4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "X5IDN4",
        "id": "X5IDN4_9BACL",
        "source_organism": {
            "taxId": "228952",
            "scientificName": "uncultured Geobacillus sp.",
            "fullName": "uncultured Geobacillus sp."
        },
        "name": "Orotidine 5'-phosphate decarboxylase",
        "description": [
            "Catalyzes the decarboxylation of orotidine 5'-monophosphate (OMP) to uridine 5'-monophosphate (UMP)"
        ],
        "length": 239,
        "sequence": "MNHPFIVALDFPTAEDVKTFLQPFQHESLFVKVGMELYYQERPEIIRYLKEQGHRIFLDLKLHDIPNTVKRAMQGLACLGVDLVNVHVAGGMKMMEAALEGLDAGTPSGESRPYCIAVTQLTSTNEQMLREQLLIERSMEETVLHYASLAHKSGLDGVVCSAKEVPLIRQAFGESFLTVTPGIRFATDEKNDQARVVTPYEARKLGASAIVVGRSITRAADSYAAYERLQREWNGEEQK",
        "proteome": null,
        "gene": "pyrF",
        "go_terms": [
            {
                "identifier": "GO:0004590",
                "name": "orotidine-5'-phosphate decarboxylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006207",
                "name": "'de novo' pyrimidine nucleobase biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0044205",
                "name": "'de novo' UMP biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "bfa259cb295edeb275c86a7b575c2fbeb1ad6dbe",
        "counters": {
            "domain_architectures": 35089,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "smart": 1,
                "cdd": 1,
                "hamap": 1,
                "ncbifam": 2,
                "panther": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 35089
        }
    }
}