General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "X0PC01",
        "id": "X0PC01_9LACO",
        "source_organism": {
            "taxId": "1423743",
            "scientificName": "Lentilactobacillus farraginis DSM 18382 = JCM 14108",
            "fullName": "Lentilactobacillus farraginis DSM 18382 = JCM 14108"
        },
        "name": "Translation initiation factor IF-1",
        "description": [
            "One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex"
        ],
        "length": 72,
        "sequence": "MAKDNVIEVEGKVVETLPNAMFRVELENGHEILAHVSGKIRMHYIRILPGDKVTVEMSPYDLTKGRITYRFK",
        "proteome": "UP000051966",
        "gene": "infA",
        "go_terms": [
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003743",
                "name": "translation initiation factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006413",
                "name": "translational initiation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "70f1d1b0829b437c03f5cbd338266a2d7b9aebd0",
        "counters": {
            "domain_architectures": 44381,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "profile": 1,
                "smart": 1,
                "pfam": 1,
                "cdd": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 44381
        }
    }
}