GET /api/protein/UniProt/W9YHA9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "W9YHA9",
        "id": "W9YHA9_9EURO",
        "source_organism": {
            "taxId": "1182542",
            "scientificName": "Capronia epimyces CBS 606.96",
            "fullName": "Capronia epimyces CBS 606.96"
        },
        "name": "Acyl-coenzyme A diphosphatase SCS3",
        "description": [
            "Fatty acyl-coenzyme A (CoA) diphosphatase that hydrolyzes fatty acyl-CoA to yield acyl-4'-phosphopantetheine and adenosine 3',5'-bisphosphate. Preferentially hydrolyzes unsaturated long-chain acyl-CoA substrates in the endoplasmic reticulum (ER) lumen. This catalytic activity is required for maintaining ER structure and for lipid droplets (LDs) biogenesis, which are lipid storage organelles involved in maintaining lipid and energy homeostasis. May directly bind to diacylglycerol (DAGs) and triacylglycerol, which is also important for LD biogenesis. May support directional budding of nacent LDs from the ER into the cytosol by reducing DAG levels at sites of LD formation. May play a role in the regulation of cell morphology and cytoskeletal organization. Involved in phospholipid biosynthesis"
        ],
        "length": 330,
        "sequence": "MPAVQRNGRTISPEKKQESSNENIPSTMTVTQGEQRPSPYLLLIYPVLLALGSLWAVISPVAAPPPNAPLAPGVASDLNVHHFHQTNYFAGKRNLINIYFVKMGWFWTTVAFVLLQSTTRPRASIAQKHYLQAALRYALVTFSWILTTQWCFGPALIDRSFTITGGQCAPHQFNEASLTDVVKLSQINSGILCKASGGKWHGGHDISGHVFILVLSSAFLLYELYIADRHSTHPHVSPQAAAAVAHNMTDEERKAVGGWESERIAKIRIWSRYFLYGVVSLDLWMLMMTAIWFHTWLEKLSGLLIAGSTIWSVFFLGDFLPQWRSIVGAL",
        "proteome": "UP000019478",
        "gene": "SCS3",
        "go_terms": [
            {
                "identifier": "GO:0010945",
                "name": "coenzyme A diphosphatase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019915",
                "name": "lipid storage",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005789",
                "name": "endoplasmic reticulum membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0008654",
                "name": "phospholipid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0df6fc065a0fc2f8a871a302178b9bf19d5ee16d",
        "counters": {
            "domain_architectures": 2223,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "hamap": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2223
        }
    }
}