HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "W9Y4N5",
"id": "W9Y4N5_9EURO",
"source_organism": {
"taxId": "1182542",
"scientificName": "Capronia epimyces CBS 606.96",
"fullName": "Capronia epimyces CBS 606.96"
},
"name": "Rho GDP-dissociation inhibitor",
"description": [
"Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them"
],
"length": 197,
"sequence": "MADDLTVDRTPGFKVGEKKTLDEYQKLDQEDEALNRWKASLGIGIAQGQSISDPNDPRLCIIKSLALEVEGRPDITIDLTQPGALESLKGKPFTIKEGSTYQMKAVFVVQHQVLSGLKYIQSVKRKGIRVGKDQEMIGSYAPNTVDKPTHTKKFAPEEAPSGMMARGHYEAVSRFVDDDDVTHLKFEWSFDIAKDWK",
"proteome": "UP000019478",
"gene": "A1O3_04853",
"go_terms": [
{
"identifier": "GO:0005094",
"name": "Rho GDP-dissociation inhibitor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0007266",
"name": "Rho protein signal transduction",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a047cc2a90c5a451e918e7e7fd5504acdc6be23f",
"counters": {
"domain_architectures": 7757,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"pfam": 1,
"cathgene3d": 1,
"panther": 1,
"prints": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 7757
}
}
}