General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "W9WK73",
        "id": "W9WK73_9EURO",
        "source_organism": {
            "taxId": "1182543",
            "scientificName": "Cladophialophora psammophila CBS 110553",
            "fullName": "Cladophialophora psammophila CBS 110553"
        },
        "name": "Flavin prenyltransferase PAD1, mitochondrial",
        "description": [
            "Flavin prenyltransferase that catalyzes the synthesis of the prenylated FMN cofactor (prenyl-FMN) for the ferulic acid decarboxylase FDC1. The prenyltransferase is metal-independent and links a dimethylallyl moiety from dimethylallyl monophosphate (DMAP) to the flavin N5 and C6 atoms of FMN"
        ],
        "length": 183,
        "sequence": "MTGATGSIIGARALEALRKLGVETHLIMSRWAEATLKYETDKYTPSDIRALATHNYSIKDVSAPISSGSFETDCMVIVPCSMKSLAAVRIGYADDLISRAADVVLKERRRLVLVVRETPLSTIQLENMTSLSRNGAIIFPPVLAFYTKPETLDDVVNQTVGRILDMFHLDTSGFERWNGMKWK",
        "proteome": "UP000019471",
        "gene": "PAD1",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a8d4bade61d095bea50675bf04b899cb1d7578d3",
        "counters": {
            "domain_architectures": 29049,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "ncbifam": 2,
                "hamap": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 29049
        }
    }
}