General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "W9WIH1",
        "id": "W9WIH1_9EURO",
        "source_organism": {
            "taxId": "1182543",
            "scientificName": "Cladophialophora psammophila CBS 110553",
            "fullName": "Cladophialophora psammophila CBS 110553"
        },
        "name": "Diphthine methyl ester synthase",
        "description": [
            "S-adenosyl-L-methionine-dependent methyltransferase that catalyzes four methylations of the modified target histidine residue in translation elongation factor 2 (EF-2), to form an intermediate called diphthine methyl ester. The four successive methylation reactions represent the second step of diphthamide biosynthesis"
        ],
        "length": 285,
        "sequence": "MLYLVGLGLADERDITVKGLEVVKRAERVYLEAYTSILHVGKDKLESLYERPVIVADREMVESSSDEILEGADKADIAFLVVGDPFGATTHTDLVLRAQELSIPVKSIPNASILNAIGATGLQLYNFGQTVSMVFFTENWKPASFYDRIRENASIGLHTLMLLDIKVKEQSLENMARGRKTYEPPRYMTVMQCAQQMLEIEEEKKVHVYAEDSLAIGCARVGADDQQFACGTLKELCNIDLGAPLHSLVLLGKRAHELEKDYIKKFAVNEETFEESWKKYHGRNQ",
        "proteome": "UP000019471",
        "gene": "A1O5_09259",
        "go_terms": [
            {
                "identifier": "GO:0008168",
                "name": "methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004164",
                "name": "diphthine synthase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0017183",
                "name": "protein histidyl modification to diphthamide",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c6fc4066a6a3d3c96c9a871fe22501df278bed0f",
        "counters": {
            "domain_architectures": 80154,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "pfam": 1,
                "cdd": 1,
                "ssf": 1,
                "ncbifam": 1,
                "hamap": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 80154
        }
    }
}