General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "W9Q538",
        "id": "W9Q538_FUSOX",
        "source_organism": {
            "taxId": "1080344",
            "scientificName": "Fusarium oxysporum f. sp. pisi HDV247",
            "fullName": "Fusarium oxysporum f. sp. pisi HDV247"
        },
        "name": "Proteasome subunit beta",
        "description": [
            "Component of the proteasome, a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity"
        ],
        "length": 203,
        "sequence": "MEVLLGITGKDFTIIAASKAAMRGATILKASDDKTRALNKHTLLAFSGEAGDTVQFAEYIQRNAQLYSMRNESDLSPSGLAHFVRGELATSLRSRKPYNVNLLMGGVDPITGKPSLYWLDYLASLADVPYAAHGYAQYYCLSILDKHHHPDITLHQGIKILTMCTDELKRRLPIDFKGMVVKAVKADGIVDIEFDDDKVVKSA",
        "proteome": null,
        "gene": "FOVG_02747",
        "go_terms": [
            {
                "identifier": "GO:0010498",
                "name": "proteasomal protein catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0030163",
                "name": "protein catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005839",
                "name": "proteasome core complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d0cadb4b1c9d733ad28db3ac45300c7c0dc1b432",
        "counters": {
            "domain_architectures": 65712,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "cdd": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 65712
        }
    }
}